PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10021327m
Common NameCARUB_v10021327mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 299aa    MW: 34609.1 Da    PI: 7.7035
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10021327mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72e-1670115147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v+ +G+ +W++Ia++++ gR++k+c++rw++ 
  Carubv10021327m  70 RGHWRPAEDAKLKELVAVYGPQNWNLIAEKLQ-GRSGKSCRLRWFNQ 115
                      899*****************************.***********996 PP

2Myb_DNA-binding60.43.7e-19122165146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eE+e+l++a++++G++ W+ Iar ++ gRt++++k++w+ 
  Carubv10021327m 122 RRAFTEEEEERLLQAHRLYGNK-WAMIARLFP-GRTDNSVKNHWHV 165
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.44865116IPR017930Myb domain
SuperFamilySSF466893.74E-2968163IPR009057Homeodomain-like
SMARTSM007175.0E-1469118IPR001005SANT/Myb domain
PfamPF002495.1E-1670115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-2771123IPR009057Homeodomain-like
CDDcd001672.93E-1273114No hitNo description
PROSITE profilePS5129427.178117171IPR017930Myb domain
SMARTSM007174.2E-16121169IPR001005SANT/Myb domain
PfamPF002495.5E-16122164IPR001005SANT/Myb domain
CDDcd001672.90E-12124164No hitNo description
Gene3DG3DSA:1.10.10.601.2E-21124170IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MSEDHHPLMD QTASSDEYFS LNINNDQHLR SYSISHREEE IRNSYLSDHS KKDTANYGSC  60
GHSSKGSVSR GHWRPAEDAK LKELVAVYGP QNWNLIAEKL QGRSGKSCRL RWFNQLDPRI  120
NRRAFTEEEE ERLLQAHRLY GNKWAMIARL FPGRTDNSVK NHWHVIMARK FREQSSTYRR  180
RKTMLPLKPL IKPNPHIFND FDPTKLALTH IVTKDQKQLM LPIPCFPGYD NGNESPLMVS  240
MLENEMVVGD YTAWTQEATT LDCLNQTEKS EMFERMNEEK KPLFFDFLGL GEGVISSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-33701717108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2493080.0AF249308.1 Arabidopsis thaliana putative transcription factor (MYB105) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006300946.10.0hypothetical protein CARUB_v10021327mg
TrEMBLR0HVG40.0R0HVG4_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.2__1220__AT1G69560.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12102896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.10.0myb domain protein 105